Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSET domain-containing protein 7/9 (Set7/9)
LigandBDBM50063670
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1463676
IC50>100000±n/a nM
Citation Kung PPHuang BZehnder LTatlock JBingham PKrivacic CGajiwala KDiehl WYu XMaegley KA SAH derived potent and selective EZH2 inhibitors. Bioorg Med Chem Lett 25:1532-7 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
SET domain-containing protein 7/9 (Set7/9)
Name:Histone-lysine N-methyltransferase SETD7
Synonyms:Histone-lysine N-methyltransferase SETD7
Type:Enzyme
Mol. Mass.:40691.12
Organism:Homo sapiens (Human)
Description:Q8WTS6
Residue:366
Sequence:
MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLE
GYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCW
IYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRP
HFELMPGNSVYHFDKSTSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNT
VMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFT
PNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF
QATQQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50063670
n/a
NameBDBM50063670
Synonyms:CHEMBL3397332
TypeSmall organic molecule
Emp. Form.C24H29N9O4S
Mol. Mass.539.61
SMILESN[C@@H](CCSC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12)C(=O)NCc1cc([nH]n1)-c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: