Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 2 |
---|
Ligand | BDBM50063864 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1463801 (CHEMBL3404964) |
---|
EC50 | 10000±n/a nM |
---|
Citation | Buzard, DJ; Schrader, TO; Zhu, X; Lehmann, J; Johnson, B; Kasem, M; Kim, SH; Kawasaki, A; Lopez, L; Moody, J; Han, S; Gao, Y; Edwards, J; Barden, J; Thatte, J; Gatlin, J; Jones, RM Design and synthesis of new tricyclic indoles as potent modulators of the S1P1 receptor. Bioorg Med Chem Lett25:659-63 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 2 |
---|
Name: | Sphingosine 1-phosphate receptor 2 |
Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38883.16 |
Organism: | Homo sapiens (Human) |
Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
Residue: | 353 |
Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
BDBM50063864 |
---|
n/a |
---|
Name | BDBM50063864 |
Synonyms: | CHEMBL3403619 | US10676467, Compound TZ 50 13 |
Type | Small organic molecule |
Emp. Form. | C26H27F3N2O3 |
Mol. Mass. | 472.4994 |
SMILES | OC(=O)CC1NCCc2c1[nH]c1ccc(OCc3ccc(C4CCCC4)c(c3)C(F)(F)F)cc21 |
Structure |
|