| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50063904 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1464106 (CHEMBL3406632) |
|---|
| EC50 | >20±n/a nM |
|---|
| Citation |  Hickey, ER; Zindell, R; Cirillo, PF; Wu, L; Ermann, M; Berry, AK; Thomson, DS; Albrecht, C; Gemkow, MJ; Riether, D Selective CB2 receptor agonists. Part 1: the identification of novel ligands through computer-aided drug design (CADD) approaches. Bioorg Med Chem Lett25:575-80 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50063904 |
|---|
| n/a |
|---|
| Name | BDBM50063904 |
|---|
| Synonyms: | CHEMBL3400940 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H23F3N4O3 |
|---|
| Mol. Mass. | 436.4275 |
|---|
| SMILES | CC(C)(C)c1cc(NC(=O)N2CC3CC2CN3C(=O)c2ccc(cc2)C(F)(F)F)no1 |TLB:8:10:16.15:13,17:16:13:10.11| |
|---|
| Structure | 
|
|---|
Search and Browse
