Reaction Details |
| Report a problem with these data |
Target | Cannabinoid receptor 2 |
---|
Ligand | BDBM50063904 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1464106 (CHEMBL3406632) |
---|
EC50 | >20±n/a nM |
---|
Citation | Hickey, ER; Zindell, R; Cirillo, PF; Wu, L; Ermann, M; Berry, AK; Thomson, DS; Albrecht, C; Gemkow, MJ; Riether, D Selective CB2 receptor agonists. Part 1: the identification of novel ligands through computer-aided drug design (CADD) approaches. Bioorg Med Chem Lett25:575-80 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cannabinoid receptor 2 |
---|
Name: | Cannabinoid receptor 2 |
Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 39690.94 |
Organism: | Homo sapiens (Human) |
Description: | P34972 |
Residue: | 360 |
Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
BDBM50063904 |
---|
n/a |
---|
Name | BDBM50063904 |
Synonyms: | CHEMBL3400940 |
Type | Small organic molecule |
Emp. Form. | C21H23F3N4O3 |
Mol. Mass. | 436.4275 |
SMILES | CC(C)(C)c1cc(NC(=O)N2CC3CC2CN3C(=O)c2ccc(cc2)C(F)(F)F)no1 |TLB:8:10:16.15:13,17:16:13:10.11| |
Structure |
|