Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor Edg-4
LigandBDBM50065611
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1463951
IC50>800±n/a nM
Citation Kusumi KShinozaki KKanaji TKurata HNaganawa AOtsuki KMatsushita TSekiguchi TKakuuchi ASeko T Discovery of novel S1P2 antagonists. Part 1: discovery of 1,3-bis(aryloxy)benzene derivatives. Bioorg Med Chem Lett 25:1479-82 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor Edg-4
Name:Lysophosphatidic acid receptor Edg-4
Synonyms:LPA receptor 2 | LPA-2 | Lysophosphatidic acid receptor 2
Type:PROTEIN
Mol. Mass.:39103.44
Organism:Homo sapiens (Human)
Description:ChEMBL_1451385
Residue:351
Sequence:
MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA
EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50065611
n/a
NameBDBM50065611
Synonyms:CHEMBL3401383
TypeSmall organic molecule
Emp. Form.C31H36FN3O5
Mol. Mass.549.633
SMILESCCC(CC)CC1(O)CCN(CC1)C(=O)Nc1cc(Oc2ccc(F)cc2)cc(Oc2ccc(cc2)C(N)=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: