Reaction Details |
| Report a problem with these data |
Target | Bcl-2-like protein 1 |
---|
Ligand | BDBM21447 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1465965 (CHEMBL3406793) |
---|
IC50 | 6.0±n/a nM |
---|
Citation | Levoin, N; Vo, DD; Gautier, F; Barillé-Nion, S; Juin, P; Tasseau, O; Grée, R A combination of in silico and SAR studies to identify binding hot spots of Bcl-xL inhibitors. Bioorg Med Chem23:1747-57 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-like protein 1 |
---|
Name: | Bcl-2-like protein 1 |
Synonyms: | Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | B2CL1_HUMAN | BCL2-like 1 isoform 1 | BCL2L | BCL2L1 | BCLX | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl-xL/Bcl-2-binding component 3 | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD) |
Type: | Mitochondrion membrane; Single-pass membrane protein |
Mol. Mass.: | 26039.60 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 233 |
Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
BDBM21447 |
---|
n/a |
---|
Name | BDBM21447 |
Synonyms: | 4-(4-{[2-(4-chlorophenyl)phenyl]methyl}piperazin-1-yl)-N-[(4-{[(2R)-4-(dimethylamino)-1-(phenylsulfanyl)butan-2-yl]amino}-3-nitrobenzene)sulfonyl]benzamide | ABT-737 | CHEMBL376408 | N-Benylpiperazine derivative, 2 | US11760752, Compound ABT-737 | US9125913, ABT-737 |
Type | Small organic molecule |
Emp. Form. | C42H45ClN6O5S2 |
Mol. Mass. | 813.427 |
SMILES | CN(C)CC[C@H](CSc1ccccc1)Nc1ccc(cc1[N+]([O-])=O)S(=O)(=O)NC(=O)c1ccc(cc1)N1CCN(Cc2ccccc2-c2ccc(Cl)cc2)CC1 |r| |
Structure |
|