| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cysteinyl leukotriene receptor 2 |
|---|
| Ligand | BDBM50066952 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1466141 (CHEMBL3404759) |
|---|
| IC50 | 25±n/a nM |
|---|
| Citation |  Itadani, S; Takahashi, S; Ima, M; Sekiguchi, T; Aratani, Y; Egashira, H; Matsumura, N; Inoue, A; Yonetomi, Y; Fujita, M; Nakayama, Y; Takeuchi, J Discovery of a potent, orally available dual CysLT1 and CysLT2 antagonist with dicarboxylic acid. Bioorg Med Chem23:2079-97 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cysteinyl leukotriene receptor 2 |
|---|
| Name: | Cysteinyl leukotriene receptor 2 |
|---|
| Synonyms: | CLTR2_HUMAN | CYSLT2 | CYSLT2R | CYSLTR2 | Cysteinyl leukotriene receptor | Cysteinyl leukotriene receptor 2 | Leukotriene Cysteinyl 2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 39657.52 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Leukotriene Cysteinyl 2 CYSLTR2 HUMAN::Q9NS75 |
|---|
| Residue: | 346 |
|---|
| Sequence: | MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSI
YVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYV
NMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQ
NGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRV
SHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACF
NPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV
|
|
|
|---|
| BDBM50066952 |
|---|
| n/a |
|---|
| Name | BDBM50066952 |
|---|
| Synonyms: | CHEMBL3403190 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H33NO6 |
|---|
| Mol. Mass. | 527.6075 |
|---|
| SMILES | OC(=O)CCCn1cc(CC(O)=O)c2c(\C=C\c3ccc(OCCCCOc4ccccc4)cc3)cccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
