Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHigh-affinity choline transporter
LigandBDBM87569
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1464243
IC50 1260±n/a nM
Citation Bollinger SREngers DWEnnis EAWright JLocuson CWLindsley CWBlakely RDHopkins CR Synthesis and structure-activity relationships of a series of 4-methoxy-3-(piperidin-4-yl)oxy benzamides as novel inhibitors of the presynaptic choline transporter. Bioorg Med Chem Lett 25:1757-60 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
High-affinity choline transporter
Name:High-affinity choline transporter
Synonyms:high affinity choline transporter 1
Type:PROTEIN
Mol. Mass.:63194.33
Organism:Homo sapiens (Human)
Description:ChEMBL_1464247
Residue:580
Sequence:
MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGG
LYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGTVDSSEVYSW
LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGASTDW
NQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFK
TLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLD
ELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM87569
n/a
NameBDBM87569
Synonyms:MLS000733239 | N-(1-phenylethyl)-4-[1-(pyridin-2-ylmethyl)piperidin-4-yl]oxy-benzamide | N-(1-phenylethyl)-4-[1-(pyridin-2-ylmethyl)piperidin-4-yl]oxybenzamide | N-(1-phenylethyl)-4-[[1-(2-pyridinylmethyl)-4-piperidinyl]oxy]benzamide | N-(1-phenylethyl)-4-[[1-(2-pyridylmethyl)-4-piperidyl]oxy]benzamide | N-(1-phenylethyl)-4-{[1-(pyridin-2-ylmethyl)piperidin-4-yl]oxy}benzamide | SMR000315874 | cid_16187262
TypeSmall organic molecule
Emp. Form.C26H29N3O2
Mol. Mass.415.5274
SMILESCC(NC(=O)c1ccc(OC2CCN(Cc3ccccn3)CC2)cc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: