Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCollagen type IV alpha-3-binding protein
LigandBDBM50067353
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1465154
EC50 4000±n/a nM
Citation Santos CFleury LRodriguez FMarkus JBerke? DDaïch AAusseil FBaudoin-Dehoux CBallereau SGénisson Y The CERT antagonist HPA-12: first practical synthesis and individual binding evaluation of the four stereoisomers. Bioorg Med Chem 23:2004-9 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Collagen type IV alpha-3-binding protein
Name:Collagen type IV alpha-3-binding protein
Synonyms:CERT | COL4A3BP | Ceramide transfer protein | Collagen type IV alpha-3-binding protein | GPBP | Goodpasture antigen-binding protein | STARD11 | START domain-containing protein 11 | StAR-related lipid transfer protein 11 | StARD11 | hCERT
Type:PROTEIN
Mol. Mass.:70818.45
Organism:Homo sapiens (Human)
Description:ChEMBL_109569
Residue:624
Sequence:
MSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDE
TEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKTESG
YGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQK
YFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHSTNGNKEKLFPHVTPKGINGID
FKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRTEEAYKNAMTELKK
KSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTSLPSGDAFS
SVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDVGGDANWQL
VVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHV
VETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPL
NNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKR
EYPKFLKRFTSYVQEKTAGKPILF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50067353
n/a
NameBDBM50067353
Synonyms:CHEMBL3401792
TypeSmall organic molecule
Emp. Form.C22H37NO3
Mol. Mass.363.5341
SMILESCCCCCCCCCCCC(=O)N[C@@H](CO)C[C@H](O)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: