Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-1 receptor-associated kinase 4
LigandBDBM50067520
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1465696
Ki>4000±n/a nM
Citation Boyd MJBandarage UKBennett HByrn RRDavies IGu WJacobs MLedeboer MWLedford BLeeman JRPerola EWang TBennani YClark MPCharifson PS Isosteric replacements of the carboxylic acid of drug candidate VX-787: Effect of charge on antiviral potency and kinase activity of azaindole-based influenza PB2 inhibitors. Bioorg Med Chem Lett 25:1990-4 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-1 receptor-associated kinase 4
Name:Interleukin-1 receptor-associated kinase 4
Synonyms:IRAK-4 | Interleukin-1 receptor-associated kinase 4 (IRAK-4) | Interleukin-1 receptor-associated kinase 4 (IRAK4) | Renal carcinoma antigen NY-REN-64
Type:Protein
Mol. Mass.:51519.08
Organism:Homo sapiens (Human)
Description:Q9NWZ3
Residue:460
Sequence:
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV
QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50067520
n/a
NameBDBM50067520
Synonyms:CHEMBL3401982
TypeSmall organic molecule
Emp. Form.C21H19F2N7O2
Mol. Mass.439.4181
SMILESFc1cnc2[nH]cc(-c3ncc(F)c(N[C@H]4C5CCC(CC5)[C@@H]4c4nc(=O)o[nH]4)n3)c2c1 |r,wU:22.24,wD:15.14,(3.52,6.58,;2.32,6.87,;1.9,8.35,;.39,8.73,;-.67,7.61,;-2.2,7.65,;-2.72,6.2,;-1.52,5.3,;-1.57,3.76,;-2.93,3.04,;-2.99,1.5,;-1.68,.68,;-1.73,-.55,;-.32,1.41,;.98,.59,;.93,-.96,;-.48,-1.66,;-.57,-3.2,;.73,-4.07,;2.12,-3.4,;.86,-3.35,;.83,-1.64,;2.26,-1.79,;3.68,-1.07,;5.04,-1.77,;6.11,-.67,;7.33,-.85,;5.4,.7,;3.88,.44,;-.27,2.95,;-.25,6.13,;1.24,5.75,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: