Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKinesin-like protein 1
LigandBDBM50068387
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1466497
EC50>1000±n/a nM
Citation Mansoor UFAngeles ARDai CYang LVitharana DBasso ADGray KTang HLiu MLiang LAllbritton OSiddiqui MA Discovery of novel spiro 1,3,4-thiadiazolines as potent, orally bioavailable and brain penetrant KSP inhibitors. Bioorg Med Chem 23:2424-34 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kinesin-like protein 1
Name:Kinesin-like protein 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:119138.97
Organism:Homo sapiens (Human)
Description:ChEMBL_1457426
Residue:1056
Sequence:
MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK
SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS
PNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE
RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS
VTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVIT
ALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNIL
NKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIV
ELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKEEY
ITSALESTEEKLHDAASKLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNS
LFNNMEELIKDGSSKQKAMLEVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVSTHV
SQIFNMILKEQSLAAESKTVLQELINVLKTDLLSSLEMILSPTVVSILKINSQLKHIFKT
SLTVADKIEDQKKELDGFLSILCNNLHELQENTICSLVESQKQCGNLTEDLKTIKQTHSQ
ELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQKFCADSDGFS
QELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNER
EQELHNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNE
TIKIGLTKLNCFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLM
MLNCSENNKEETIPDVDVEEAVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGK
DKENRGINTLERSKVEETTEHLVTKSRLPLRAQINL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50068387
n/a
NameBDBM50068387
Synonyms:CHEMBL3402348
TypeSmall organic molecule
Emp. Form.C18H15F2N3O2S
Mol. Mass.375.392
SMILESNCC(=O)N1N=C(SC11CCOc2ccccc12)c1cc(F)ccc1F |c:5|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: