| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Similar to alpha-tubulin isoform 1 |
|---|
| Ligand | BDBM50022542 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1466693 (CHEMBL3404291) |
|---|
| IC50 | 2400±n/a nM |
|---|
| Citation |  Zhang, X; Raghavan, S; Ihnat, M; Hamel, E; Zammiello, C; Bastian, A; Mooberry, SL; Gangjee, A The design, synthesis and biological evaluation of conformationally restricted 4-substituted-2,6-dimethylfuro[2,3-d]pyrimidines as multi-targeted receptor tyrosine kinase and microtubule inhibitors as potential antitumor agents. Bioorg Med Chem23:2408-23 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Similar to alpha-tubulin isoform 1 |
|---|
| Name: | Similar to alpha-tubulin isoform 1 |
|---|
| Synonyms: | Similar to alpha-tubulin isoform 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10383.05 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_104716 |
|---|
| Residue: | 99 |
|---|
| Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
|---|
| BDBM50022542 |
|---|
| n/a |
|---|
| Name | BDBM50022542 |
|---|
| Synonyms: | CHEMBL3297898 | US10189853, Compound 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H17N3O2 |
|---|
| Mol. Mass. | 283.3251 |
|---|
| SMILES | COc1ccc(cc1)N(C)c1nc(C)nc2oc(C)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
