Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHepatocyte growth factor activator
LigandBDBM50063698
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1466697
Ki 25±n/a nM
Citation Franco FMJones DEHarris PKHan ZWildman SAJarvis CMJanetka JW Structure-based discovery of small molecule hepsin and HGFA protease inhibitors: Evaluation of potency and selectivity derived from distinct binding pockets. Bioorg Med Chem 23:2328-43 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hepatocyte growth factor activator
Name:Hepatocyte growth factor activator
Synonyms:HGF activator | HGFA | HGFAC | Hepatocyte growth factor activator | Hepatocyte growth factor activator long chain | Hepatocyte growth factor activator short chain
Type:PROTEIN
Mol. Mass.:70690.18
Organism:Homo sapiens (Human)
Description:ChEMBL_109514
Residue:655
Sequence:
MGRWAWVPSPWPPPGLGPFLLLLLLLLLLPRGFQPQPGGNRTESPEPNATATPAIPTILV
TSVTSETPATSAPEAEGPQSGGLPPPPRAVPSSSSPQAQALTEDGRPCRFPFRYGGRMLH
ACTSEGSAHRKWCATTHNYDRDRAWGYCVEATPPPGGPAALDPCASGPCLNGGSCSNTQD
PQSYHCSCPRAFTGKDCGTEKCFDETRYEYLEGGDRWARVRQGHVEQCECFGGRTWCEGT
RHTACLSSPCLNGGTCHLIVATGTTVCACPPGFAGRLCNIEPDERCFLGNGTGYRGVAST
SASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDNDERPWCYVVKDSALSWE
YCRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHP
WLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIE
KYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGW
GHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGG
PLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIRPPRRLVAPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50063698
n/a
NameBDBM50063698
Synonyms:4-Guanidino-benzoic acid 6-carbamimidoyl-naphthalen-2-yl ester | 4-Guanidino-benzoic acid 6-carbamimidoyl-naphthalen-2-yl ester(FUT-175) | CHEMBL273264
TypeSmall organic molecule
Emp. Form.C19H17N5O2
Mol. Mass.347.3706
SMILES[#7]\[#6](-[#7])=[#7]/c1ccc(cc1)-[#6](=O)-[#8]-c1ccc2cc(ccc2c1)-[#6](-[#7])=[#7]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: