| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50346329 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1467661 (CHEMBL3411023) |
|---|
| Ki | 10±n/a nM |
|---|
| Citation |  Guillemyn, K; Kleczkowska, P; Lesniak, A; Dyniewicz, J; Van der Poorten, O; Van den Eynde, I; Keresztes, A; Varga, E; Lai, J; Porreca, F; Chung, NN; Lemieux, C; Mika, J; Rojewska, E; Makuch, W; Van Duppen, J; Przewlocka, B; Vanden Broeck, J; Lipkowski, AW; Schiller, PW; Tourwé, D; Ballet, S Synthesis and biological evaluation of compact, conformationally constrained bifunctional opioid agonist - neurokinin-1 antagonist peptidomimetics. Eur J Med Chem92:64-77 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50346329 |
|---|
| n/a |
|---|
| Name | BDBM50346329 |
|---|
| Synonyms: | (R)-2-((S)-2-amino-3-(4-hydroxy-2,6-dimethylphenyl)propanamido)-N-((S)-2-(2-((3,5-bis(trifluoromethyl)benzyl)(methyl)amino)-2-oxoethyl)-3-oxo-2,3,4,5-tetrahydro-1H-benzo[c]azepin-4-yl)-5-guanidinopentanamide | CHEMBL1782141 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C39H46F6N8O5 |
|---|
| Mol. Mass. | 820.8236 |
|---|
| SMILES | [#6]-[#7](-[#6]-c1cc(cc(c1)C(F)(F)F)C(F)(F)F)-[#6](=O)-[#6]-[#7]-1-[#6]-c2ccccc2-[#6]-[#6@H](-[#7]-[#6](=O)-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#7]-[#6](=O)-[#6@@H](-[#7])-[#6]-c2c(-[#6])cc(-[#8])cc2-[#6])-[#6]-1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
