Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein arginine methyltransferase 8 (PRMT8)
LigandBDBM50070953
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1468800
IC50 1740±n/a nM
Citation Hu HOwens EASu HYan LLevitz AZhao XHenary MZheng YG Exploration of cyanine compounds as selective inhibitors of protein arginine methyltransferases: synthesis and biological evaluation. J Med Chem 58:1228-43 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein arginine methyltransferase 8 (PRMT8)
Name:Protein arginine N-methyltransferase 8
Synonyms:HRMT1L3 | HRMT1L4 | Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4 | PRMT8 | Protein arginine N-methyltransferase 8 | Protein arginine N-methyltransferase 8 (PRMT8)
Type:Protein
Mol. Mass.:45293.70
Organism:Homo sapiens (Human)
Description:n/a
Residue:394
Sequence:
MGMKHSSRCLLLRRKMAENAAESTEVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGK
MSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGS
GTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVD
IIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWE
NVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQR
NDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISM
KPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50070953
n/a
NameBDBM50070953
Synonyms:CHEMBL3409550
TypeSmall organic molecule
Emp. Form.C49H49BrN2
Mol. Mass.745.831
SMILES[Br-].CC1(C)\C(=C/C=C/C2=[N+](CCCc3ccccc3)c3ccc4ccccc4c3C2(C)C)N(CCCc2ccccc2)c2ccc3ccccc3c12 |c:7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: