Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein arginine N-methyltransferase 5
LigandBDBM50070950
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1468799
IC50 35400±n/a nM
Citation Hu HOwens EASu HYan LLevitz AZhao XHenary MZheng YG Exploration of cyanine compounds as selective inhibitors of protein arginine methyltransferases: synthesis and biological evaluation. J Med Chem 58:1228-43 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein arginine N-methyltransferase 5
Name:PRMT5/MEP50 complex
Synonyms:72 kDa ICln-binding protein | HRMT1L5 | Histone-arginine N-methyltransferase PRMT5 | IBP72 | JBP1 | Jak-binding protein 1 | PRMT5 | PRMT5/MEP50 complex | Protein arginine N-methyltransferase 5 (PRMT5) | Protein arginine methyltransferase 5 (PRMT5) | SKB1 | SKB1 homolog | SKB1Hs | Shk1 kinase-binding protein 1 homolog
Type:Enzyme
Mol. Mass.:72679.99
Organism:Homo sapiens (Human)
Description:O14744
Residue:637
Sequence:
MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAK
NRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLP
AFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYS
GEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNK
KGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELF
AKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV
LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM
REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKL
YNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEF
PVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICV
RFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50070950
n/a
NameBDBM50070950
Synonyms:CHEMBL3409562
TypeSmall organic molecule
Emp. Form.C33H40Br3IN2
Mol. Mass.831.301
SMILES[I-].CCCCN1\C(=C\C=C(/Br)\C=C\C2=[N+](CCCC)c3ccc(Br)cc3C2(C)C)C(C)(C)c2cc(Br)ccc12 |c:12|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: