Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPantothenate kinase 1
LigandBDBM50071384
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1469796
IC50 14690±n/a nM
Citation Sharma LKLeonardi RLin WBoyd VAGoktug AShelat AAChen TJackowski SRock CO A high-throughput screen reveals new small-molecule activators and inhibitors of pantothenate kinases. J Med Chem 58:1563-8 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pantothenate kinase 1
Name:Pantothenate kinase 1
Synonyms:PANK | PANK1 | Pantothenate kinase 1 | Pantothenic acid kinase 1 | hPanK | hPanK1
Type:PROTEIN
Mol. Mass.:64345.71
Organism:Homo sapiens (Human)
Description:ChEMBL_109585
Residue:598
Sequence:
MLKLVGGGGGQDWACSVAGTSLGGEEAAFEVARPGDQGKAGGGSPGWGCAGIPDSAPGAG
VLQAGAVGPARGGQGAEEVGESAGGGEERRVRHPQAPALRLLNRKPQGGSGEIKTPENDL
QRGRLSRGPRTAPPAPGMGDRSGQQERSVPHSPGAPVGTSAAAVNGLLHNGFHPPPVQPP
HVCSRGPVGGSDAAPQRLPLLPELQPQPLLPQHDSPAKKCRLRRRMDSGRKNRPPFPWFG
MDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSNTAYGKTGIRDVHLELKNLTM
CGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHK
LDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVS
ILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYG
GDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENID
RVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50071384
n/a
NameBDBM50071384
Synonyms:CHEMBL1603189
TypeSmall organic molecule
Emp. Form.C22H23N5O2
Mol. Mass.389.4503
SMILESCOc1ccc(CNC(=O)CCc2c(C)nc3c4cccnc4nn3c2C)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: