Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPantothenate kinase 3
LigandBDBM50071452
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1469797
IC50>56000±n/a nM
Citation Sharma LKLeonardi RLin WBoyd VAGoktug AShelat AAChen TJackowski SRock CO A high-throughput screen reveals new small-molecule activators and inhibitors of pantothenate kinases. J Med Chem 58:1563-8 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pantothenate kinase 3
Name:Pantothenate kinase 3
Synonyms:PANK3 | Pantothenate kinase 3 | Pantothenic acid kinase 3 | hPanK3
Type:PROTEIN
Mol. Mass.:41093.59
Organism:Homo sapiens (Human)
Description:ChEMBL_109587
Residue:370
Sequence:
MKIKDAKKPSFPWFGMDIGGTLVKLSYFEPIDITAEEEQEEVESLKSIRKYLTSNVAYGS
TGIRDVHLELKDLTLFGRRGNLHFIRFPTQDLPTFIQMGRDKNFSTLQTVLCATGGGAYK
FEKDFRTIGNLHLHKLDELDCLVKGLLYIDSVSFNGQAECYYFANASEPERCQKMPFNLD
DPYPLLVVNIGSGVSILAVHSKDNYKRVTGTSLGGGTFLGLCSLLTGCESFEEALEMASK
GDSTQADKLVRDIYGGDYERFGLPGWAVASSFGNMIYKEKRESVSKEDLARATLVTITNN
IGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLEHEGYFGAV
GALLGLPNFS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50071452
n/a
NameBDBM50071452
Synonyms:CHEMBL3410399
TypeSmall organic molecule
Emp. Form.C22H21N5O3
Mol. Mass.403.4338
SMILESCOC(=O)c1cccc(NC(=O)CCc2c(C)nc3c4cccnc4nn3c2C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: