Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPantothenate kinase 2, mitochondrial
LigandBDBM50071456
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1469794
IC50 92±n/a nM
Citation Sharma LKLeonardi RLin WBoyd VAGoktug AShelat AAChen TJackowski SRock CO A high-throughput screen reveals new small-molecule activators and inhibitors of pantothenate kinases. J Med Chem 58:1563-8 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pantothenate kinase 2, mitochondrial
Name:Pantothenate kinase 2, mitochondrial
Synonyms:C20orf48 | PANK2 | Pantothenate kinase 2, mitochondrial | Pantothenic acid kinase 2 | hPanK2
Type:PROTEIN
Mol. Mass.:62702.05
Organism:Homo sapiens (Human)
Description:ChEMBL_109586
Residue:570
Sequence:
MRRLGPFHPRVHWAAPPSLSSGLHRLLFLRGTRIPSSTTLSPPRHDSLSLDGGTVNPPRV
REPTGREAFGPSPASSDWLPARWRNGRGGRPRARLCSGWTAAEEARRNPTLGGLLGRQRL
LLRMGGGRLGAPMERHGRASATSVSSAGEQAAGDPEGRRQEPLRRRASSASVPAVGASAE
GTRRDRLGSYSGPTSVSRQRVESLRKKRPLFPWFGLDIGGTLVKLVYFEPKDITAEEEEE
EVESLKSIRKYLTSNVAYGSTGIRDVHLELKDLTLCGRKGNLHFIRFPTHDMPAFIQMGR
DKNFSSLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYIDSVGFNGRSQC
YYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGTSLGGGTFFG
LCCLLTGCTTFEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEK
REAVSKEDLARATLITITNNIGSIARMCALNENINQVVFVGNFLRINTIAMRLLAYALDY
WSKGQLKALFSEHEGYFGAVGALLELLKIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50071456
n/a
NameBDBM50071456
Synonyms:CHEMBL3410246
TypeSmall organic molecule
Emp. Form.C21H21N5OS
Mol. Mass.391.489
SMILESCSc1cccc(NC(=O)CCc2c(C)nc3c4cccnc4nn3c2C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: