Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine 3-monooxygenase
LigandBDBM50072079
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1467949
IC50 6.2±n/a nM
Citation Toledo-Sherman LMPrime MEMrzljak LBeconi MGBeresford ABrookfield FABrown CJCardaun ICourtney SMDijkman UHamelin-Flegg EJohnson PDKempf VLyons KMatthews KMitchell WLO'Connell CPena PPowell KRassoulpour AReed LReindl WSelvaratnam SFriley WWWeddell DAWent NEWheelan PWinkler CWinkler DWityak JYarnold CJYates DMunoz-Sanjuan IDominguez C Development of a series of aryl pyrimidine kynurenine monooxygenase inhibitors as potential therapeutic agents for the treatment of Huntington's disease. J Med Chem 58:1159-83 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kynurenine 3-monooxygenase
Name:Kynurenine 3-monooxygenase
Synonyms:Kmo | Kynurenine 3-hydroxylase | Kynurenine 3-monooxygenase
Type:PROTEIN
Mol. Mass.:54550.12
Organism:Mus musculus
Description:ChEMBL_109577
Residue:479
Sequence:
MASSDTQGKRVAVIGGGLVGALNACFLAKRNFQVDVYEAREDIRVAKSARGRSINLALSY
RGRQALKAIGLEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISRENLNKDLLT
AVESYANAKVHFGHKLSKCIPEEGVLTVLGPDKVPRDVTCDLVVGCDGAYSTVRAHLMKK
PRFDYTQQYIPHGYMELTIPPKNGEYAMEPNCLHIWPRNAYMMIALPNMDKSFTCTLFMP
FEEFERLPTRSDVLDFFQKNFPDAIPLMGEQALMRDFFLLPAQPMISVKCSPFHLKSHCV
LMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRFRIPDDHAISDLS
MYNYIEMRAHVNSRWFLFQKLLDKFLHAIMPSTFIPLYTMVAFTRIRYHEAVLRWHWQKK
VINRGLFVLGSLIAIGGTYLLVHHLSLRPLEFLRRPAWMGTTGYWTRSTDISLQVPWSY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50072079
n/a
NameBDBM50072079
Synonyms:CHEMBL3407913
TypeSmall organic molecule
Emp. Form.C12H9ClN2O2
Mol. Mass.248.665
SMILESCc1ccc(cc1Cl)-c1cc(ncn1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: