Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLIM domain kinase 1
LigandBDBM50072670
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1467118
IC50 210±n/a nM
Citation Yin YZheng KEid NHoward SJeong JHYi FGuo JPark CMBibian MWu WHernandez PPark HWu YLuo JLLoGrasso PVFeng Y Bis-aryl urea derivatives as potent and selective LIM kinase (Limk) inhibitors. J Med Chem 58:1846-61 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
LIM domain kinase 1
Name:LIM domain kinase 1
Synonyms:LIM domain kinase 1 | LIMK-1 | Limk | Limk1
Type:PROTEIN
Mol. Mass.:72598.76
Organism:Rattus norvegicus
Description:ChEMBL_109573
Residue:647
Sequence:
MRLTLLCCTWREERMGEEGSELPVCASCSQSIYDGQYLQALNADWHADCFRCCECSTSLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEHITKGLVMVGGELKYHPECFICLACGNFIGD
GDTYTLVEHSKLYCGQCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASAHGKRGLSV
SIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHIGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDSLGHGPVSDPSPLASPVHTPSGQAGSSARQKPVLRSCSID
TSPGAGSLVSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENRNVVVADFG
LARLMIDEKGQSEDLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EQWLETLRMHLAGHLPLGPQLEQLERGFWETYRRGESSLPAHPEVPD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50072670
n/a
NameBDBM50072670
Synonyms:CHEMBL3410053
TypeSmall organic molecule
Emp. Form.C23H21ClFN5O2
Mol. Mass.453.897
SMILESCc1[nH]c2ncnc(-c3ccc(NC(=O)N(CCO)c4ccc(Cl)cc4)c(F)c3)c2c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: