Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLIM domain kinase 1
LigandBDBM50072680
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1467101
IC50 315±n/a nM
Citation Yin YZheng KEid NHoward SJeong JHYi FGuo JPark CMBibian MWu WHernandez PPark HWu YLuo JLLoGrasso PVFeng Y Bis-aryl urea derivatives as potent and selective LIM kinase (Limk) inhibitors. J Med Chem 58:1846-61 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
LIM domain kinase 1
Name:LIM domain kinase 1
Synonyms:LIMK | LIMK-1 | LIMK1
Type:Enzyme Catalytic Domain
Mol. Mass.:72591.81
Organism:Homo sapiens (Human)
Description:gi_4505001
Residue:647
Sequence:
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGD
GDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSV
SIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSID
RSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFG
LARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50072680
n/a
NameBDBM50072680
Synonyms:CHEMBL3410029
TypeSmall organic molecule
Emp. Form.C20H16FN5O
Mol. Mass.361.3723
SMILESCc1c[nH]c2ncnc(-c3ccc(NC(=O)Nc4cccc(F)c4)cc3)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: