Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50073599 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1467416 (CHEMBL3411700) |
---|
Ki | 1.4±n/a nM |
---|
Citation | Banister, SD; Beinat, C; Wilkinson, SM; Shen, B; Bartoli, C; Selleri, S; Da Pozzo, E; Martini, C; Chin, FT; Kassiou, M Ether analogues of DPA-714 with subnanomolar affinity for the translocator protein (TSPO). Eur J Med Chem93:392-400 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50073599 |
---|
n/a |
---|
Name | BDBM50073599 |
Synonyms: | CHEMBL3408970 |
Type | Small organic molecule |
Emp. Form. | C28H29F3N4O2 |
Mol. Mass. | 510.5507 |
SMILES | CCN(CC)C(=O)Cc1c(nn2c(C)cc(C)nc12)-c1ccc(OCc2ccccc2C(F)(F)F)cc1 |
Structure |
|