| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member B10 |
|---|
| Ligand | BDBM13066 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1473105 (CHEMBL3421434) |
|---|
| IC50 | 1900±n/a nM |
|---|
| Citation |  Maccari, R; Ottaną, R Targeting aldose reductase for the treatment of diabetes complications and inflammatory diseases: new insights and future directions. J Med Chem58:2047-67 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member B10 |
|---|
| Name: | Aldo-keto reductase family 1 member B10 |
|---|
| Synonyms: | AK1BA_HUMAN | AKR1B10 | AKR1B11 | ARL-1 | ARP | Aldo-keto reductase family 1 member B10 | Aldo-keto reductase family 1 member B10 (AKR1B10) | Aldo-keto reductase family member 1B10 (AKR1B10) | Aldose reductase-like | Aldose reductase-related protein | SI reductase | Small intestine reductase | hARP |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 36024.67 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O60218. 1ZUA; 4JII; 4GQ0 |
|---|
| Residue: | 316 |
|---|
| Sequence: | MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQ
EKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD
DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKP
VTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK
HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACN
VLQSSHLEDYPFNAEY
|
|
|
|---|
| BDBM13066 |
|---|
| n/a |
|---|
| Name | BDBM13066 |
|---|
| Synonyms: | 2-{2-[(2,6-dichlorophenyl)amino]phenyl}acetic acid | CHEMBL139 | Diclofenac | US11337935, Compound Diclofenac | US11478464, Compound Diclofenac | US11786535, Compound Diclofenac | {2-[(2,6-dichlorophenyl)amino]phenyl}acetic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H11Cl2NO2 |
|---|
| Mol. Mass. | 296.149 |
|---|
| SMILES | OC(=O)Cc1ccccc1Nc1c(Cl)cccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
