Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSET domain-containing protein 7/9 (Set7/9)
LigandBDBM50075073
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1473578
Ki 0.330000±n/a nM
Citation Kaniskan HÜKonze KDJin J Selective inhibitors of protein methyltransferases. J Med Chem 58:1596-629 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
SET domain-containing protein 7/9 (Set7/9)
Name:Histone-lysine N-methyltransferase SETD7
Synonyms:Histone-lysine N-methyltransferase SETD7
Type:Enzyme
Mol. Mass.:40691.12
Organism:Homo sapiens (Human)
Description:Q8WTS6
Residue:366
Sequence:
MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLE
GYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCW
IYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRP
HFELMPGNSVYHFDKSTSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNT
VMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFT
PNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF
QATQQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50075073
n/a
NameBDBM50075073
Synonyms:CHEMBL3414622
TypeSmall organic molecule
Emp. Form.C23H25F4N3O3S
Mol. Mass.499.522
SMILESFc1cc(cc2CCNCc12)S(=O)(=O)N[C@H](Cc1cccc(c1)C(F)(F)F)C(=O)N1CCCC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: