Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-arginine N-methyltransferase 1
LigandBDBM50396981
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1473653
Ki>20000±n/a nM
Citation Kaniskan HÜKonze KDJin J Selective inhibitors of protein methyltransferases. J Med Chem 58:1596-629 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-arginine N-methyltransferase 1
Name:Protein-arginine N-methyltransferase 1
Synonyms:Protein arginine N-methyltransferase 1 (PRMT1) | Protein arginine methyltransferase 1 (PRMT1)
Type:Protein
Mol. Mass.:41506.52
Organism:Homo sapiens (Human)
Description:n/a
Residue:361
Sequence:
MENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDE
VRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIV
KANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGL
IFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNAC
LIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYT
HWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRM
R
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50396981
n/a
NameBDBM50396981
Synonyms:CHEMBL2171174
TypeSmall organic molecule
Emp. Form.C15H22N6O5S
Mol. Mass.398.437
SMILESCNc1ncnc2n(cnc12)[C@@H]1O[C@H](CSCC[C@H](N)C(O)=O)[C@@H](O)[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: