Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNMT3A2/3L complex
LigandBDBM50430056
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1473707
IC50 8000±n/a nM
Citation Erdmann AHalby LFahy JArimondo PB Targeting DNA methylation with small molecules: what's next? J Med Chem 58:2569-83 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNMT3A2/3L complex
Name:DNMT3A2/3L complex
Synonyms:DNA (cytosine-5)-methyltransferase 3A | DNA MTase HsaIIIA | DNA methyltransferase HsaIIIA | Dnmt3a | M.HsaIIIA
Type:PROTEIN
Mol. Mass.:101857.24
Organism:Homo sapiens (Human)
Description:ChEMBL_1510405
Residue:912
Sequence:
MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPV
ESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEG
AAETLPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSL
RQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVE
EASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDDEPEYEDGRGFGIGELVWGKL
RGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYN
KQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPK
GLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLV
YEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTIC
CGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRRED
WPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRY
IASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPAR
KGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMI
DAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSI
KQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRH
LFAPLKEYFACV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50430056
n/a
NameBDBM50430056
Synonyms:CHEMBL2336409 | SGI-1027
TypeSmall organic molecule
Emp. Form.C27H23N7O
Mol. Mass.461.5178
SMILESCc1cc(Nc2ccc(NC(=O)c3ccc(Nc4ccnc5ccccc45)cc3)cc2)nc(N)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: