Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntegrase
LigandBDBM50075211
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1473740
IC50 3800±n/a nM
Citation Vernekar SKLiu ZNagy EMiller LKirby KAWilson DJKankanala JSarafianos SGParniak MAWang Z Design, synthesis, biochemical, and antiviral evaluations of C6 benzyl and C6 biarylmethyl substituted 2-hydroxylisoquinoline-1,3-diones: dual inhibition against HIV reverse transcriptase-associated RNase H and polymerase with antiviral activities. J Med Chem 58:651-64 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Integrase
Name:Integrase
Synonyms:Integrase
Type:PROTEIN
Mol. Mass.:32203.43
Organism:Human immunodeficiency virus 1
Description:ChEMBL_106649
Residue:288
Sequence:
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50075211
n/a
NameBDBM50075211
Synonyms:CHEMBL3414857
TypeSmall organic molecule
Emp. Form.C16H13NO3
Mol. Mass.267.2793
SMILESON1C(=O)Cc2cc(Cc3ccccc3)ccc2C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: