| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50075214 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1473740 (CHEMBL3418257) |
|---|
| IC50 | 5700±n/a nM |
|---|
| Citation |  Vernekar, SK; Liu, Z; Nagy, E; Miller, L; Kirby, KA; Wilson, DJ; Kankanala, J; Sarafianos, SG; Parniak, MA; Wang, Z Design, synthesis, biochemical, and antiviral evaluations of C6 benzyl and C6 biarylmethyl substituted 2-hydroxylisoquinoline-1,3-diones: dual inhibition against HIV reverse transcriptase-associated RNase H and polymerase with antiviral activities. J Med Chem58:651-64 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | pol |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32203.43 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_106649 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50075214 |
|---|
| n/a |
|---|
| Name | BDBM50075214 |
|---|
| Synonyms: | CHEMBL3414876 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H24N2O6S |
|---|
| Mol. Mass. | 516.565 |
|---|
| SMILES | Cc1ccc(cc1)S([O-])(=O)=O.ON1C(=O)Cc2cc(Cc3ccc(cc3)-c3cc[nH+]cc3)ccc2C1=O |
|---|
| Structure | 
|
|---|
Search and Browse
