| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator BAX |
|---|
| Ligand | BDBM50078024 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1471766 (CHEMBL3417877) |
|---|
| Ki | 1700±n/a nM |
|---|
| Citation |  Stornaiuolo, M; La Regina, G; Passacantilli, S; Grassia, G; Coluccia, A; La Pietra, V; Giustiniano, M; Cassese, H; Di Maro, S; Brancaccio, D; Taliani, S; Ialenti, A; Silvestri, R; Martini, C; Novellino, E; Marinelli, L Structure-based lead optimization and biological evaluation of BAX direct activators as novel potential anticancer agents. J Med Chem58:2135-48 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator BAX |
|---|
| Name: | Apoptosis regulator BAX |
|---|
| Synonyms: | Apoptosis regulator BAX | BAX | BAX_HUMAN | BCL2L4 | Bcl-2-like protein 4 | Bcl2-L-4 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 21181.15 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_100916 |
|---|
| Residue: | 192 |
|---|
| Sequence: | MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
|
|
|
|---|
| BDBM50078024 |
|---|
| n/a |
|---|
| Name | BDBM50078024 |
|---|
| Synonyms: | CHEMBL3417404 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H21N5O3 |
|---|
| Mol. Mass. | 415.4445 |
|---|
| SMILES | CCOc1ccccc1N\N=C1\C(C)=NN(C1=O)c1cc(O)cc(c1)-c1ccncc1 |c:14| |
|---|
| Structure | 
|
|---|
Search and Browse
