Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-lipoxygenase/FLAP
LigandBDBM50078040
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1471925
IC50 2.4±n/a nM
Citation Takahashi HRiether DBartolozzi ABosanac TBerger VBinetti RBroadwater JChen ZCrux RDe Lombaert SDave RDines JAFadra-Khan TFlegg AGarrigou MHao MHHuber JHutzler JMKerr SKotey ALiu WLo HYLoke PLMahaney PEMorwick TMNapier SOlague APack EPadyana AKThomson DSTye HWu LZindell RMAbeywardane ASimpson T Synthesis, SAR, and series evolution of novel oxadiazole-containing 5-lipoxygenase activating protein inhibitors: discovery of 2-[4-(3-{(r)-1-[4-(2-amino-pyrimidin-5-yl)-phenyl]-1-cyclopropyl-ethyl}-[1,2,4]oxadiazol-5-yl)-pyrazol-1-yl]-N,N-dimethyl-acetamide (BI 665915). J Med Chem 58:1669-90 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-lipoxygenase/FLAP
Name:5-lipoxygenase/FLAP
Synonyms:5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | FLAP | MK-886-binding protein
Type:Enzyme
Mol. Mass.:18159.90
Organism:Homo sapiens (Human)
Description:P20292
Residue:161
Sequence:
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50078040
n/a
NameBDBM50078040
Synonyms:CHEMBL3417425
TypeSmall organic molecule
Emp. Form.C19H16N6OS
Mol. Mass.376.435
SMILESNc1ncc(cn1)-c1ccc(cc1)C1(CCC1)c1noc(n1)-c1cscn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: