Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBcl-2-like protein 1
LigandBDBM50078166
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1472607
Ki>10000±n/a nM
Citation Bruncko MWang LSheppard GSPhillips DCTahir SKXue JErickson SFidanze SFry EHasvold LJenkins GJJin SJudge RAKovar PJMadar DNimmer PPark CPetros AMRosenberg SHSmith MLSong XSun CTao ZFWang XXiao YZhang HTse CLeverson JDElmore SWSouers AJ Structure-guided design of a series of MCL-1 inhibitors with high affinity and selectivity. J Med Chem 58:2180-94 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bcl-2-like protein 1
Name:Bcl-2-like protein 1
Synonyms:Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | BCL2-like 1 isoform 1 | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD)
Type:Mitochondrion membrane; Single-pass membrane protein
Mol. Mass.:26039.60
Organism:Homo sapiens (Human)
Description:n/a
Residue:233
Sequence:
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50078166
n/a
NameBDBM50078166
Synonyms:CHEMBL3417580
TypeSmall organic molecule
Emp. Form.C19H25NO2
Mol. Mass.299.4073
SMILESOC(=O)c1[nH]c2ccccc2c1CCCCC1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: