Reaction Details |
| Report a problem with these data |
Target | Cathepsin D |
---|
Ligand | BDBM142394 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1470596 (CHEMBL3420009) |
---|
IC50 | >81000±n/a nM |
---|
Citation | Butler, CR; Brodney, MA; Beck, EM; Barreiro, G; Nolan, CE; Pan, F; Vajdos, F; Parris, K; Varghese, AH; Helal, CJ; Lira, R; Doran, SD; Riddell, DR; Buzon, LM; Dutra, JK; Martinez-Alsina, LA; Ogilvie, K; Murray, JC; Young, JM; Atchison, K; Robshaw, A; Gonzales, C; Wang, J; Zhang, Y; O'Neill, BT Discovery of a series of efficient, centrally efficacious BACE1 inhibitors through structure-based drug design. J Med Chem58:2678-702 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cathepsin D |
---|
Name: | Cathepsin D |
Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
Type: | Enzyme |
Mol. Mass.: | 44551.72 |
Organism: | Homo sapiens (Human) |
Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
Residue: | 412 |
Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
BDBM142394 |
---|
n/a |
---|
Name | BDBM142394 |
Synonyms: | US8933221, 4 |
Type | Small organic molecule |
Emp. Form. | C14H15F3N2OS |
Mol. Mass. | 316.342 |
SMILES | NC1=N[C@]2(CO[C@@H](CF)C[C@H]2CS1)c1ccc(F)cc1F |t:1| |
Structure |
|