Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMacrophage-expressed gene 1 protein
LigandBDBM50078844
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1472482
IC50 5800±n/a nM
Citation Filosa RPeduto ASchaible AMKrauth VWeinigel CBarz DPetronzi CBruno FRoviezzo FSpaziano GD'Agostino BDe Rosa MWerz O Novel series of benzoquinones with high potency against 5-lipoxygenase in human polymorphonuclear leukocytes. Eur J Med Chem 94:132-9 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Macrophage-expressed gene 1 protein
Name:Macrophage-expressed gene 1 protein
Synonyms:MPEG1 | Macrophage gene 1 protein | Macrophage-expressed gene 1 protein | Mpg-1
Type:PROTEIN
Mol. Mass.:78593.74
Organism:Homo sapiens (Human)
Description:ChEMBL_109592
Residue:716
Sequence:
MNNFRATILFWAAAAWAKSGKPSGEMDEVGVQKCKNALKLPVLEVLPGGGWDNLRNVDMG
RVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELS
LFSKVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISD
RLENNQTRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASA
GLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHL
VAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNF
QANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVH
LLSQIHEEGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFG
GLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPL
VDPAISRDLGAPSLKKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPFTRPP
LMSQAATNTVIVTNSENARSWIKDSQTHQWRLGEPIELRRAMNVIHGDGGGLSGGAAAGV
TVGVTTILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50078844
n/a
NameBDBM50078844
Synonyms:CHEMBL3416173
TypeSmall organic molecule
Emp. Form.C19H30O4
Mol. Mass.322.4391
SMILESCCCCCCCCCCCCC1=C(O)C(=O)C=C(OC)C1=O |c:12,t:17|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: