Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-interacting serine/threonine-protein kinase 2
LigandBDBM50298223
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1470961
Ki 880±n/a nM
Citation Yu MLi PBasnet SKKumarasiri MDiab STeo TAlbrecht HWang S Discovery of 4-(dihydropyridinon-3-yl)amino-5-methylthieno[2,3-d]pyrimidine derivatives as potent Mnk inhibitors: synthesis, structure-activity relationship analysis and biological evaluation. Eur J Med Chem 95:116-26 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-interacting serine/threonine-protein kinase 2
Name:MAP kinase-interacting serine/threonine-protein kinase 1/2
Synonyms:GPRK7 | MAP kinase signal-integrating kinase 2 | MAP kinase-interacting serine/threonine-protein kinase 2 (MKNK2) | MAP kinase-interacting serine/threonine-protein kinase 2 (MnK2) | MAP-kinase interacting kinase 2 (MNK2) | MKNK2 | MNK2
Type:Protein
Mol. Mass.:51870.79
Organism:Homo sapiens (Human)
Description:Q9HBH9
Residue:465
Sequence:
MVQKKPAELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAK
KRGKKKKRGRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPG
HIRSRVFREVEMLYQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNEL
EASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFDLGSGIKLNGDCS
PISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGRCG
SDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLVRDAKQRLSAA
QVLQHPWVQGCAPENTLPTPMVLQRNSCAKDLTSFAAEAIAMNRQLAQHDEDLAEEEAAG
QGQPVLVRATSRCLQLSPPSQSKLAQRRQRASLSSAPVVLVGDHA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50298223
n/a
NameBDBM50298223
Synonyms:CGP-57380 | CHEMBL1240885 | CHEMBL576817 | N-(4-fluorophenyl)-3H-pyrazolo[3,4-d]pyrimidine-3,4-diamine
TypeSmall organic molecule
Emp. Form.C11H9FN6
Mol. Mass.244.2278
SMILESNc1ncnc2n[nH]c(Nc3ccc(F)cc3)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: