Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-interacting serine/threonine-protein kinase 1
LigandBDBM50079449
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1470960
Ki 5000±n/a nM
Citation Yu MLi PBasnet SKKumarasiri MDiab STeo TAlbrecht HWang S Discovery of 4-(dihydropyridinon-3-yl)amino-5-methylthieno[2,3-d]pyrimidine derivatives as potent Mnk inhibitors: synthesis, structure-activity relationship analysis and biological evaluation. Eur J Med Chem 95:116-26 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-interacting serine/threonine-protein kinase 1
Name:MAP kinase-interacting serine/threonine-protein kinase 1
Synonyms:MAP Kinase-Interacting Protein Kinase (MNK1) | MAP kinase signal-integrating kinase 1 | MAP kinase-interacting serine/threonine-protein kinase 1 (MnK1) | MAP kinase-interacting serine/threonine-protein kinase MNK1 | MAP-kinase interacting kinase 1 (MNK1) | MAPK signal-integrating kinase 1
Type:Serine/threonine-protein kinase
Mol. Mass.:51342.85
Organism:Homo sapiens (Human)
Description:Q9BUB5
Residue:465
Sequence:
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAY
AKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRF
YLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPS
GLTAAPTSLGSSDPPTSASQVAGTTGIAHRDLKPENILCESPEKVSPVKICDFDLGSGMK
LNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKRCDLWSLGVVLYIMLSGYPP
FVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAK
QRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL
AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079449
n/a
NameBDBM50079449
Synonyms:CHEMBL3417204
TypeSmall organic molecule
Emp. Form.C19H23N5O3S
Mol. Mass.401.483
SMILESCOCCCNC(=O)c1sc2ncnc(Nc3cc(C)cn(C)c3=O)c2c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: