Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target2-heptyl-4(1H)-quinolone synthase PqsD
LigandBDBM50079636
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1472518
IC50 1000±n/a nM
Citation Sahner JHEmpting MKamal AWeidel EGroh MBörger CHartmann RW Exploring the chemical space of ureidothiophene-2-carboxylic acids as inhibitors of the quorum sensing enzyme PqsD from Pseudomonas aeruginosa. Eur J Med Chem 96:14-21 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
2-heptyl-4(1H)-quinolone synthase PqsD
Name:2-heptyl-4(1H)-quinolone synthase PqsD
Synonyms:2-heptyl-4(1H)-quinolone synthase PqsD | 3-oxoacyl-(Acyl carrier protein) synthase III | 3-oxoacyl-ACP synthase | ERS445055_04170 | PA8380_44470 | PAE221_04722 | PQB biosynthetic 3-oxoacyl-[acyl-carrier-protein] synthase III | YQ19_24710 | pqsD
Type:PROTEIN
Mol. Mass.:36357.84
Organism:Pseudomonas aeruginosa
Description:ChEMBL_109728
Residue:337
Sequence:
MGNPILAGLGFSLPKRQVSNHDLVGRINTSDEFIVERTGVRTRYHVEPEQAVSALMVPAA
RQAIEAAGLLPEDIDLLLVNTLSPDHHDPSQACLIQPLLGLRHIPVLDIRAQCSGLLYGL
QMARGQILAGLARHVLVVCGEVLSKRMDCSDRGRNLSILLGDGAGAVVVSAGESLDDGLL
DLRLGADGNYFDLLMTAAPGSASPTFLDENVLREGGGEFLMRGRPMFEHASQTLVRIAGE
MLAAHELTLDDIDHVICHQPNLRILDAVQEQLGIPQHKFAVTVDRLGNMASASTPVTLAM
FWPDIQPGQRVLVLTYGSGATWGAALYRKPEEVNRPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079636
n/a
NameBDBM50079636
Synonyms:CHEMBL2413670
TypeSmall organic molecule
Emp. Form.C13H11NO3
Mol. Mass.229.2313
SMILESOC(c1ccccc1)c1ccccc1[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: