Reaction Details |
| Report a problem with these data |
Target | Heme oxygenase 2 |
---|
Ligand | BDBM50079989 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1470661 (CHEMBL3420440) |
---|
IC50 | 900±n/a nM |
---|
Citation | Salerno, L; Pittalą, V; Romeo, G; Modica, MN; Marrazzo, A; Siracusa, MA; Sorrenti, V; Di Giacomo, C; Vanella, L; Parayath, NN; Greish, K Novel imidazole derivatives as heme oxygenase-1 (HO-1) and heme oxygenase-2 (HO-2) inhibitors and their cytotoxic activity in human-derived cancer cell lines. Eur J Med Chem96:162-72 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Heme oxygenase 2 |
---|
Name: | Heme oxygenase 2 |
Synonyms: | HMOX2_RAT | Heme Oxygenase 2 (HO-2) | Heme oxygenase 2 | Hmox2 |
Type: | Enzyme |
Mol. Mass.: | 35754.99 |
Organism: | Rattus norvegicus (rat) |
Description: | HO-2 obtained from rat brain was used in enzyme assays. |
Residue: | 315 |
Sequence: | MSSEVETSEGVDESENNSTAPEKENHTKMADLSELLKEGTKEAHDRAENTQFVKDFLKGN
IKKELFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPTELHRKEALIKDMEYFFGENW
EEQVKCSEAAQKYVDRIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTG
EGTQFYLFEHVDNAQQFKQFYRARMNALDLSMKTKERIVEEANKAFEYNMQIFSELDQAG
SMLTKETLEDGLPVHDGKGDVRKCPFYAAQPDKGTLGGSNCPFRTAMAVLRKPSLQLILA
ASVALVAGLLAWYYM
|
|
|
BDBM50079989 |
---|
n/a |
---|
Name | BDBM50079989 |
Synonyms: | CHEMBL3415253 |
Type | Small organic molecule |
Emp. Form. | C15H16ClN3S2 |
Mol. Mass. | 337.891 |
SMILES | Clc1ccc2sc(SCCCCCn3ccnc3)nc2c1 |
Structure |
|