| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Matrix protein 2 [1-96] |
|---|
| Ligand | BDBM50079994 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1471017 (CHEMBL3420249) |
|---|
| IC50 | 22600±n/a nM |
|---|
| Citation |  Rey-Carrizo, M; Gazzarrini, S; Llabrés, S; Frigolé-Vivas, M; Juárez-Jiménez, J; Font-Bardia, M; Naesens, L; Moroni, A; Luque, FJ; Vázquez, S New polycyclic dual inhibitors of the wild type and the V27A mutant M2 channel of the influenza A virus with unexpected binding mode. Eur J Med Chem96:318-29 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Matrix protein 2 [1-96] |
|---|
| Name: | Matrix protein 2 [1-96] |
|---|
| Synonyms: | M | M2_I72A2 | Matrix protein 2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11051.96 |
|---|
| Organism: | Influenza A virus |
|---|
| Description: | ChEMBL_1453980 |
|---|
| Residue: | 96 |
|---|
| Sequence: | MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK
RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIEL
|
|
|
|---|
| BDBM50079994 |
|---|
| n/a |
|---|
| Name | BDBM50079994 |
|---|
| Synonyms: | CHEMBL3305169 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H21N3 |
|---|
| Mol. Mass. | 219.3259 |
|---|
| SMILES | NC(=N)N1CC2C(C1)C1CCC2C2CCC12 |TLB:7:6:10.9:15.12,THB:4:5:10.9:15.12,13:12:10.9:5.6,14:15:10.9:5.6| |
|---|
| Structure | 
|
|---|
Search and Browse
