Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 4
LigandBDBM50080578
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1475227
EC50>100000±n/a nM
Citation Doering SRTodorovic AHaskell-Luevano C Melanocortin antagonist tetrapeptides with minimal agonist activity at the mouse melanocortin-3 receptor. ACS Med Chem Lett 6:123-7 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 4
Name:Melanocortin receptor 4
Synonyms:MC4-R
Type:PROTEIN
Mol. Mass.:36964.43
Organism:Mus musculus
Description:ChEMBL_1498850
Residue:332
Sequence:
MNSTHHHGMYTSLHLWNRSSYGLHGNASESLGKGHPDGGCYEQLFVSPEVFVTLGVISLL
ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVN
IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVS
GVLFIIYSDSSAVIICLISMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGTN
MKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPL
IYALRSQELRKTFKEIICFYPLGGICELSSRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50080578
n/a
NameBDBM50080578
Synonyms:CHEMBL3422432
TypeSmall organic molecule
Emp. Form.C41H46IN9O5
Mol. Mass.871.7657
SMILESCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@H](Cc1ccc(I)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1ccc2ccccc2c1)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: