Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmine oxidase [flavin-containing] A
LigandBDBM50080871
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1475315
IC50 110±n/a nM
Citation Valente SRodriguez VMercurio CVianello PSaponara BCirilli RCiossani GLabella DMarrocco BRuoppolo GBotrugno OADessanti PMinucci SMattevi AVarasi MMai A Pure Diastereomers of a Tranylcypromine-Based LSD1 Inhibitor: Enzyme Selectivity and In-Cell Studies. ACS Med Chem Lett 6:173-7 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Amine oxidase [flavin-containing] A
Name:Monoamine oxidase
Synonyms:Amine oxidase (flavin-containing) A | MAO-A | Monoamine oxidase | Monoamine oxidase type A | Monoamine oxidase type A (MAO A) | Monoamine oxidase type A (MAO A) | Monoamine oxidase type A (MAOA)
Type:Protein
Mol. Mass.:59689.53
Organism:Homo sapiens (Human)
Description:P21397
Residue:527
Sequence:
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50080871
n/a
NameBDBM50080871
Synonyms:CHEMBL3421672
TypeSmall organic molecule
Emp. Form.C26H28ClN3O3
Mol. Mass.465.972
SMILESCl.N[C@H]1C[C@@H]1c1ccc(NC(=O)[C@H](Cc2ccccc2)NC(=O)OCc2ccccc2)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: