Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 3
LigandBDBM50080877
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1475329
IC50>2000±n/a nM
Citation Van der Poorten OFehér KBuysse KFeytens DZoi ISchwartz SDMartins JCTourwé DCai MHruby VJBallet S Azepinone-Containing Tetrapeptide Analogues of Melanotropin Lead to Selective hMC4R Agonists and hMC5R Antagonist. ACS Med Chem Lett 6:192-7 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 3
Name:Melanocortin receptor 3
Synonyms:MC3-R | MC3R | Melanocortin MC3
Type:Enzyme
Mol. Mass.:36044.86
Organism:Homo sapiens (Human)
Description:P41968
Residue:323
Sequence:
MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVI
LAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF
DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFI
VYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFREILCGCNGMNLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50080877
n/a
NameBDBM50080877
Synonyms:CHEMBL3421679
TypeSmall organic molecule
Emp. Form.C38H45N9O5
Mol. Mass.707.8212
SMILESCC(=O)N[C@H]1Cc2ccccc2CN([C@H](Cc2ccccc2)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc2c[nH]c3ccccc23)C(N)=O)C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: