Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-glutamine gamma-glutamyltransferase 2 (TG2)
LigandBDBM50083726
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1475047
IC50 48±n/a nM
Citation Avery CAPease RJSmith KBoothby MBuckley HMGrant PJFishwick CW () cis-Bisamido epoxides: A novel series of potent FXIII-A inhibitors. Eur J Med Chem 98:49-53 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-glutamine gamma-glutamyltransferase 2 (TG2)
Name:Protein-glutamine gamma-glutamyltransferase 2 (TG2)
Synonyms:Protein-glutamine gamma-glutamyltransferase | Tissue transglutaminase | Tissue transglutaminase (TG2) | Transglutaminase 2 (TGM2) | Transglutaminase C | Transglutaminase-2
Type:Protein
Mol. Mass.:77309.30
Organism:Homo sapiens (Human)
Description:P21980
Residue:687
Sequence:
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK
SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
LHKLVVNFESDKLKAVKGFRNVIIGPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50083726
n/a
NameBDBM50083726
Synonyms:CHEMBL3423194
TypeSmall organic molecule
Emp. Form.C10H9ClN2O3
Mol. Mass.240.643
SMILESNC(=O)[C@H]1O[C@H]1C(=O)Nc1cccc(Cl)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: