Reaction Details |
| Report a problem with these data |
Target | Hematopoietic prostaglandin D synthase |
---|
Ligand | BDBM50084155 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1477164 (CHEMBL3428604) |
---|
IC50 | 26±n/a nM |
---|
Citation | Edfeldt, F; Evenäs, J; Lepistö, M; Ward, A; Petersen, J; Wissler, L; Rohman, M; Sivars, U; Svensson, K; Perry, M; Feierberg, I; Zhou, XH; Hansson, T; Narjes, F Identification of indole inhibitors of human hematopoietic prostaglandin D2 synthase (hH-PGDS). Bioorg Med Chem Lett25:2496-500 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hematopoietic prostaglandin D synthase |
---|
Name: | Hematopoietic prostaglandin D synthase |
Synonyms: | GSTS | Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | HPGDS | HPGDS_HUMAN | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | PTGDS2 | Prostaglandin D | Prostaglandin D Synthase |
Type: | Enzyme |
Mol. Mass.: | 23341.07 |
Organism: | Homo sapiens (Human) |
Description: | The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag. |
Residue: | 199 |
Sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
|
|
|
BDBM50084155 |
---|
n/a |
---|
Name | BDBM50084155 |
Synonyms: | CHEMBL3425953 |
Type | Small organic molecule |
Emp. Form. | C21H18N4O |
Mol. Mass. | 342.3938 |
SMILES | O=C(CCc1cccnc1)Nc1cncc(c1)-c1cccc2[nH]ccc12 |
Structure |
|