| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Similar to alpha-tubulin isoform 1 |
|---|
| Ligand | BDBM50084939 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1476789 (CHEMBL3429443) |
|---|
| IC50 | 1500±n/a nM |
|---|
| Citation |  Romagnoli, R; Baraldi, PG; Salvador, MK; Prencipe, F; Lopez-Cara, C; Schiaffino Ortega, S; Brancale, A; Hamel, E; Castagliuolo, I; Mitola, S; Ronca, R; Bortolozzi, R; Porcù, E; Basso, G; Viola, G Design, synthesis, in vitro, and in vivo anticancer and antiangiogenic activity of novel 3-arylaminobenzofuran derivatives targeting the colchicine site on tubulin. J Med Chem58:3209-22 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Similar to alpha-tubulin isoform 1 |
|---|
| Name: | Similar to alpha-tubulin isoform 1 |
|---|
| Synonyms: | Similar to alpha-tubulin isoform 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10383.05 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_104716 |
|---|
| Residue: | 99 |
|---|
| Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
|---|
| BDBM50084939 |
|---|
| n/a |
|---|
| Name | BDBM50084939 |
|---|
| Synonyms: | CHEMBL3427379 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H23NO7 |
|---|
| Mol. Mass. | 401.4098 |
|---|
| SMILES | CCOC(=O)c1oc2cc(OC)ccc2c1Nc1cc(OC)c(OC)c(OC)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
