Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCatechol-O-methyltransferase
LigandBDBM50086211
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1477937
IC50 57±n/a nM
Citation Harrison STPoslusney MSMulhearn JJZhao ZKett NRSchubert JWMelamed JYAllison TJPatel SBSanders JMSharma SSmith RFHall DLRobinson RGSachs NAHutson PHWolkenberg SEBarrow JC Synthesis and Evaluation of Heterocyclic Catechol Mimics as Inhibitors of Catechol-O-methyltransferase (COMT). ACS Med Chem Lett 6:318-23 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Catechol-O-methyltransferase
Name:Catechol O-methyltransferase
Synonyms:n/a
Type:Enzyme
Mol. Mass.:29594.09
Organism:Rattus norvegicus (Rat)
Description:n/a
Residue:264
Sequence:
MPLAAVSLGLLLLALLLLLRHLGWGLVTIFWFEYVLQPVHNLIMGDTKEQRILRYVQQNA
KPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMA
RLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDM
VFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSY
LEYMKVVDGLEKAIYQGPSSPDKS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50086211
n/a
NameBDBM50086211
Synonyms:CHEMBL3425738
TypeSmall organic molecule
Emp. Form.C19H17NO3
Mol. Mass.307.3432
SMILESCC(O)c1cc(=O)c(O)cn1-c1cccc(c1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: