Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCatechol O-methyltransferase (MB-COMT)
LigandBDBM50086215
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1477936
IC50 170±n/a nM
Citation Harrison STPoslusney MSMulhearn JJZhao ZKett NRSchubert JWMelamed JYAllison TJPatel SBSanders JMSharma SSmith RFHall DLRobinson RGSachs NAHutson PHWolkenberg SEBarrow JC Synthesis and Evaluation of Heterocyclic Catechol Mimics as Inhibitors of Catechol-O-methyltransferase (COMT). ACS Med Chem Lett 6:318-23 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Catechol O-methyltransferase (MB-COMT)
Name:Catechol O-methyltransferase
Synonyms:Catechol O-methyltransferase
Type:Enzyme
Mol. Mass.:30030.67
Organism:Homo sapiens (Human)
Description:P21964
Residue:271
Sequence:
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRIL
NHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG
YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKY
DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFE
CTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50086215
n/a
NameBDBM50086215
Synonyms:CHEMBL3425743 | US9260413, Example 3
TypeSmall organic molecule
Emp. Form.C17H14N2O2
Mol. Mass.278.3053
SMILESCn1c(ncc(O)c1=O)-c1cccc(c1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: