Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCatechol O-methyltransferase (MB-COMT)
LigandBDBM50086234
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1477936
IC50 400±n/a nM
Citation Harrison STPoslusney MSMulhearn JJZhao ZKett NRSchubert JWMelamed JYAllison TJPatel SBSanders JMSharma SSmith RFHall DLRobinson RGSachs NAHutson PHWolkenberg SEBarrow JC Synthesis and Evaluation of Heterocyclic Catechol Mimics as Inhibitors of Catechol-O-methyltransferase (COMT). ACS Med Chem Lett 6:318-23 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Catechol O-methyltransferase (MB-COMT)
Name:Catechol O-methyltransferase
Synonyms:Catechol O-methyltransferase
Type:Enzyme
Mol. Mass.:30030.67
Organism:Homo sapiens (Human)
Description:P21964
Residue:271
Sequence:
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRIL
NHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG
YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKY
DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFE
CTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50086234
n/a
NameBDBM50086234
Synonyms:CHEMBL3425721
TypeSmall organic molecule
Emp. Form.C12H9NO2S
Mol. Mass.231.27
SMILESOc1cn-2c(CSc3ccccc-23)cc1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: