Reaction Details |
| Report a problem with these data |
Target | RAC-alpha serine/threonine-protein kinase |
---|
Ligand | BDBM50086441 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1476379 (CHEMBL3430009) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Zhang, CH; Zheng, MW; Li, YP; Lin, XD; Huang, M; Zhong, L; Li, GB; Zhang, RJ; Lin, WT; Jiao, Y; Wu, XA; Yang, J; Xiang, R; Chen, LJ; Zhao, YL; Cheng, W; Wei, YQ; Yang, SY Design, Synthesis, and Structure-Activity Relationship Studies of 3-(Phenylethynyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine Derivatives as a New Class of Src Inhibitors with Potent Activities in Models of Triple Negative Breast Cancer. J Med Chem58:3957-74 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
RAC-alpha serine/threonine-protein kinase |
---|
Name: | RAC-alpha serine/threonine-protein kinase |
Synonyms: | AKT phosphorylation (p-AKT) | AKT1 | AKT1/PPP1CA | AKT1_HUMAN | C-AKT | PKB | PKB alpha | Protein kinase Akt-1 | Protein kinase B | Protein kinase B (AKT1) | Protein kinase B (Akt 1) | Protein kinase B (Akt) | Protein kinase B alpha | Protein kinase B alpha (AKT1) | Proto-oncogene Akt (Akt1) | Proto-oncogene c-Akt (AKT) | Proto-oncogene c-Akt (AKT1) | RAC | RAC-PK-alpha | RAC-alpha serine/threonine-protein kinase (AKT) | RAC-alpha serine/threonine-protein kinase (AKT1) | RAC-alpha serine/threonine-protein kinase (pAKT) |
Type: | Enzyme |
Mol. Mass.: | 55681.25 |
Organism: | Homo sapiens (Human) |
Description: | P31749 |
Residue: | 480 |
Sequence: | MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
|
|
|
BDBM50086441 |
---|
n/a |
---|
Name | BDBM50086441 |
Synonyms: | CHEMBL3426225 | US10266537, Compound 3 |
Type | Small organic molecule |
Emp. Form. | C30H31F3N8O |
Mol. Mass. | 576.6153 |
SMILES | CCn1nc(C#Cc2cc(ccc2C)C(=O)Nc2ccc(CN3CCN(C)CC3)c(c2)C(F)(F)F)c2c(N)ncnc12 |
Structure |
|