Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50087826 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1478287 (CHEMBL3428527) |
---|
Ki | 5.0±n/a nM |
---|
Citation | Burford, NT; Livingston, KE; Canals, M; Ryan, MR; Budenholzer, LM; Han, Y; Shang, Y; Herbst, JJ; O'Connell, J; Banks, M; Zhang, L; Filizola, M; Bassoni, DL; Wehrman, TS; Christopoulos, A; Traynor, JR; Gerritz, SW; Alt, A Discovery, synthesis, and molecular pharmacology of selective positive allosteric modulators of thed-opioid receptor. J Med Chem58:4220-9 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50087826 |
---|
n/a |
---|
Name | BDBM50087826 |
Synonyms: | CHEMBL3426789 |
Type | Small organic molecule |
Emp. Form. | C31H34O4 |
Mol. Mass. | 470.5993 |
SMILES | Cc1ccccc1COc1ccc(cc1)C1C2=C(CC(C)(C)CC2=O)OC2=C1C(=O)CC(C)(C)C2 |c:29,t:18| |
Structure |
|