Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-8 receptors, CXCR2
LigandBDBM150812
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1476503
IC50 21±n/a nM
Citation Maeda DYPeck AMSchuler ADQuinn MTKirpotina LNWicomb WNAuten RLGundla RZebala JA Boronic acid-containing CXCR1/2 antagonists: Optimization of metabolic stability, in vivo evaluation, and a proposed receptor binding model. Bioorg Med Chem Lett 25:2280-4 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-8 receptors, CXCR2
Name:Interleukin-8 receptors, CXCR1/CXCR2
Synonyms:C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | Interleukin-8 receptor B
Type:Protein
Mol. Mass.:40767.88
Organism:Homo sapiens (Human)
Description:P25025
Residue:360
Sequence:
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM150812
n/a
NameBDBM150812
Synonyms:US8981106, 2 (SX-576) | USRE47267, Compound 2
TypeSmall organic molecule
Emp. Form.C20H15BF4N2O4S
Mol. Mass.466.214
SMILESOB(O)c1ccc(OC(F)(F)F)cc1CSc1ccc(cn1)C(=O)Nc1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: